Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109602 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 545 (ZNF545) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF545 antibody: synthetic peptide directed towards the C terminal of human ZNF545.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
KAFSRYSQLISHQSIHIGVKPYDCKECGKAFRLLS
QLTQHQSIHIGEKPY- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references High-throughput sequencing of complete human mtDNA genomes from the Philippines.
Gunnarsdóttir ED, Li M, Bauchet M, Finstermeier K, Stoneking M
Genome research 2011 Jan;21(1):1-11
Genome research 2011 Jan;21(1):1-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Brain; WB Suggested Anti-ZNF545 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human brain; ZNF545 antibody - C-terminal region (AP42065PU-N) in Human Brain cells using Western Blot