H00002649-B01

NR6A1 antibody from Abnova Corporation
CT150, GCNF, GCNF1, RTR

Antibody data

Product number
H00002649-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002649-B01, RRID:AB_1113817
Product name
NR6A1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00002649-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NR6A1 protein.
Antigen sequence
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGF
CQDELAELDPGTNDRAEQRTCLICGDRATGLHYGI
ISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQR
NRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIG
PVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSS
PGNRASESNQPSPGSTLSSRSVELNGFMAFREQYM
GMSVPPHYQYIPHLFSYSGHSPLLPQQARSLDPQS
YSLIHQLLSAEDLEPLGTPMLIEDGYAVTQAELFA
LLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLL
SSTWQELILLSSLTVYSKQIFGELADVTAKYSPSD
EELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYA
CMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDF
TEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLE
QLPLLFKVVLHSCKTSVGKE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -