SAB1400109

NR6A1 antibody from Sigma-Aldrich
CT150, GCNF, GCNF1, RTR
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1400109
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400109, RRID:AB_1849618
Product name
Anti-NR6A1 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400109
Antibody type
Polyclonal
Antigen
NR6A1 (NP_001480.3, a.a. 1-475) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGF
CQDELAELDPGTNDRAEQRTCLICGDRATGLHYGI
ISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQR
NRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIG
PVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSS
PGNRASESNQPSPGSTLSSRSVELNGFMAFREQYM
GMSVPPHYQYIPHLFSYSGHSPLLPQQARSLDPQS
YSLIHQLLSAEDLEPLGTPMLIEDGYAVTQAELFA
LLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLL
SSTWQELILLSSLTVYSKQIFGELADVTAKYSPSD
EELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYA
CMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDF
TEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLE
Storage
-20C
Provider Type Product Number
- No reagents -