Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024467 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024467, RRID:AB_1858842
- Product name
- Anti-WIPF2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPP
LRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPE
EYKHFQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A complex of ZO-1 and the BAR-domain protein TOCA-1 regulates actin assembly at the tight junction.
Cortical F-actin stabilization generates apical–lateral patterns of junctional contractility that integrate cells into epithelia
N-WASP regulates the epithelial junctional actin cytoskeleton through a non-canonical post-nucleation pathway
Van Itallie CM, Tietgens AJ, Krystofiak E, Kachar B, Anderson JM
Molecular biology of the cell 2015 Aug 1;26(15):2769-87
Molecular biology of the cell 2015 Aug 1;26(15):2769-87
Cortical F-actin stabilization generates apical–lateral patterns of junctional contractility that integrate cells into epithelia
Wu S, Gomez G, Michael M, Verma S, Cox H, Lefevre J, Parton R, Hamilton N, Neufeld Z, Yap A
Nature Cell Biology 2014 January;16(2):167-178
Nature Cell Biology 2014 January;16(2):167-178
N-WASP regulates the epithelial junctional actin cytoskeleton through a non-canonical post-nucleation pathway
Kovacs E, Verma S, Ali R, Ratheesh A, Hamilton N, Akhmanova A, Yap A
Nature Cell Biology 2011 July;13(8):934-943
Nature Cell Biology 2011 July;13(8):934-943
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-WIPF2 antibody HPA024467 (A) shows similar pattern to independent antibody HPA024000 (B).
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-WIPF2 antibody. Corresponding WIPF2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-WIPF2 antibody HPA024467 (A) shows similar protein distribution across tissues to independent antibody HPA024000 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-WIPF2 antibody HPA024467.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-WIPF2 antibody HPA024467.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-WIPF2 antibody HPA024467.
- Sample type
- HUMAN
