HPA027766

VAC14 antibody from Sigma-Aldrich
ArPIKfyve, FLJ10305, TAX1BP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027766
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027766, RRID:AB_1848651
Product name
Anti-VAC14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027766
Antibody type
Polyclonal
Antigen
Protein VAC14 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IVQVLNCHLSDTAIGMMTRIAVLKWLYHLYIKTPR
KMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEI
ASSPAGQTDDPGPLDGPDLQASHSELQVPTPGRAG
LLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFS
S
Storage
-20C
Provider Type Product Number
- No reagents -