SAB1400627

VAC14 antibody from Sigma-Aldrich
ArPIKfyve, FLJ10305, TAX1BP2
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1400627
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400627, RRID:AB_1848649
Product name
Anti-VAC14 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400627
Antibody type
Polyclonal
Antigen
VAC14 (NP_060522.3, a.a. 1-782) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEK
LVREFVAQNNTVQIKHVIQTLSQEFALSQHPHSRK
GGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDA
DSRLRYYACEALYNIVKVARGAVLPHFNVLFDGLS
KLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVS
FIPLLRERIYSNNQYARQFIISWILVLESVPDINL
LDYLPEILDGLFQILGDNGKEIRKMCEVVLGEFLK
EIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMC
WMREFIQLAGRVMLPYSSGILTAVLPCLAYDDRKK
SIKEVANVCNQSLMKLVTPEDDELDELRPGQRQAE
PTPDDALPKQEGTASGGPDGSCDSSFSSGISVFTA
ASTERAPVTLHLDGIVQVLNCHLSDTAIGMMTRIA
VLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDES
Storage
-20C
Provider Type Product Number
- No reagents -