Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182421 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and BTB Domain Containing 20 (ZBTB20) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZBTB20 antibody: synthetic peptide directed towards the middle region of human ZBTB20
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
SNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETL
TSNLR MPLTLTSNTQ- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Repression of AIM-1 kinase mRNA as part of a program of genes regulated by Mpl ligand.
Identification and characterization of DPZF, a novel human BTB/POZ zinc finger protein sharing homology to BCL-6.
Zhang Y, Sun S, Chen WC, Kaluzhny Y, Chinnappan D, Yu G, Ravid K
Biochemical and biophysical research communications 2001 Apr 6;282(3):844-9
Biochemical and biophysical research communications 2001 Apr 6;282(3):844-9
Identification and characterization of DPZF, a novel human BTB/POZ zinc finger protein sharing homology to BCL-6.
Zhang W, Mi J, Li N, Sui L, Wan T, Zhang J, Chen T, Cao X
Biochemical and biophysical research communications 2001 Apr 13;282(4):1067-73
Biochemical and biophysical research communications 2001 Apr 13;282(4):1067-73
No comments: Submit comment
No validations: Submit validation data