H00203523-B01

ZNF449 antibody from Abnova Corporation
FLJ23614, ZSCAN19

Antibody data

Product number
H00203523-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00203523-B01, RRID:AB_1116294
Product name
ZNF449 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00203523-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF449 protein.
Antigen sequence
MAVALGCAIQASLNQGSVFQEYDTDCEVFRQRFRQ
FQYREAAGPHEAFNKLWELCCQWLKPKMRSKEQIL
ELLVLEQFLTILPTEIETWVREHCPENRERVVSLI
EDLQRELEIPEQQVDMHDMLLEELAPVGTAHIPPT
MHLESPALQVMGPAQEAPVAEAWIPQAGPPELNYG
ATGECQNFLDPGYPLPKLDMNFSLENREEPWVKEL
QDSKEMKQLLDSKIGFEIGIENEEDTSKQKKMETM
YPFIVTLEGNALQGPILQKDYVQLENQWETPPEDL
QTDLAKLVDQQNPTLGETPENSNLEEPLNPKPHKK
KSPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEP
HKCPECGKRFLRSSDLYRHQRLHTGERPYECTVCK
KRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGS
SLKRHLKTHTGEKPHRCHNCGKSFSRLTALTLHQR
THTEERPFKCNYCGKSFRQRPSLVIHLRIHTGEKP
YKCTHCSKSFRQRAGLIMHQVTHFRGLI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -