ABIN1109591

ZNF449 antibody from antibodies-online
FLJ23614, ZSCAN19

Antibody data

Product number
ABIN1109591
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 449 (ZNF449) (Middle Region) antibody
Provider product page
antibodies-online - ABIN1109591
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF449 antibody: synthetic peptide directed towards the middle region of human ZNF449.
Description
Purified on peptide immunoaffinity column
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
LENREEPWVKELQDSKEMKQLLDSKIGFEIGIENE
EDTSKQKKMETMYPF
Epitope
Middle Region
Vial size
50 μg
Storage
Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -