AV31647

ZNF449 antibody from MilliporeSigma / Merck KGaA
FLJ23614, ZSCAN19
No application information provided.

Antibody data

Product number
AV31647
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV31647, RRID:AB_1859278
Product name
Anti-ZNF449 (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV31647
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF449 with an internal ID of P23924
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKQLLDSKIGFEIGIENEEDTSKQKKMETMYPFIV
TLEGNALQGPILQKD
Storage
-20C
Provider Type Product Number
- No reagents -