Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010873 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010873, RRID:AB_1078126
- Product name
- Anti-ALDH9A1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEI
LDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPH
LERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDG
YYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of 4-Trimethylaminobutyraldehyde Dehydrogenase (TMABA-DH) as a Candidate Serum Autoantibody Target for Kawasaki Disease.
Protein Extraction of Formalin-fixed, Paraffin-embedded Tissue Enables Robust Proteomic Profiles by Mass Spectrometry
Matsunaga A, Harita Y, Shibagaki Y, Shimizu N, Shibuya K, Ono H, Kato H, Sekine T, Sakamoto N, Igarashi T, Hattori S
PloS one 2015;10(5):e0128189
PloS one 2015;10(5):e0128189
Protein Extraction of Formalin-fixed, Paraffin-embedded Tissue Enables Robust Proteomic Profiles by Mass Spectrometry
Scicchitano M, Dalmas D, Boyce R, Thomas H, Frazier K
Journal of Histochemistry and Cytochemistry 2009 August;57(9):849-860
Journal of Histochemistry and Cytochemistry 2009 August;57(9):849-860
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN