HPA001040

antibody from Atlas Antibodies

Targeting: FHL1 bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA

Antibody data

Submit

Validation data

Product number: HPA001040 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001040, RRID:AB_1848541
Product name: Anti-FHL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRC AKCLHPLANETFVAKDNKILCNKCTTREDSPKCKG CFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FHL1 protein structure - HPA001040 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and pancreas tissues using HPA001040 antibody. Corresponding FHL1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells.
Sample type: HUMAN