Explore
Validate
LearnH00055832-M01
antibody from Abnova Corporation
Targeting: CAND1
DKFZp434M1414, KIAA0829, TIP120, TIP120A
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055832-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055832-M01, RRID:AB_489920
- Product name
- CAND1 monoclonal antibody (M01), clone 5D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAND1.
- Antigen sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQ
KDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVK
CLGPLVSKVKEYQVETIVDTLCTNMLSDKE- Isotype
- IgG
- Antibody clone number
- 5D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CAND1 promotes PLK4-mediated centriole overduplication and is frequently disrupted in prostate cancer.
Korzeniewski N, Hohenfellner M, Duensing S
Neoplasia (New York, N.Y.) 2012 Sep;14(9):799-806
Neoplasia (New York, N.Y.) 2012 Sep;14(9):799-806
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CAND1 monoclonal antibody (M01), clone 5D7 Western Blot analysis of CAND1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CAND1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
