Explore
Validate
LearnH00007205-M04
antibody from Abnova Corporation
Targeting: TRIP6
MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP1, ZRP-1
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007205-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007205-M04, RRID:AB_566250
- Product name
- TRIP6 monoclonal antibody (M04), clone 4B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIP6.
- Antigen sequence
SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADR
GGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
QAYEPPPPPAYRTGSLKPNPASPLPASP- Isotype
- IgG
- Antibody clone number
- 4B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TRIP6 monoclonal antibody (M04), clone 4B7 Western Blot analysis of TRIP6 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 monoclonal antibody (M04), clone 4B7.Lane 1: TRIP6 transfected lysate(50.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TRIP6 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TRIP6 on HeLa cell. [antibody concentration 35 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
