Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002629-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002629-M01, RRID:AB_464151
- Product name
- GBA monoclonal antibody (M01), clone 2E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GBA.
- Antigen sequence
SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDD
FQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLA
SPWTSPTWLKTNGAVNGKGS- Isotype
- IgG
- Antibody clone number
- 2E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Reduced glucocerebrosidase is associated with increased α-synuclein in sporadic Parkinson's disease.
Parkin-mediated ubiquitination of mutant glucocerebrosidase leads to competition with its substrates PARIS and ARTS.
Gaucher disease paradigm: from ERAD to comorbidity.
Characterization of the ERAD process of the L444P mutant glucocerebrosidase variant.
Characterization of Gaucher disease bone marrow mesenchymal stromal cells reveals an altered inflammatory secretome.
Murphy KE, Gysbers AM, Abbott SK, Tayebi N, Kim WS, Sidransky E, Cooper A, Garner B, Halliday GM
Brain : a journal of neurology 2014 Mar;137(Pt 3):834-48
Brain : a journal of neurology 2014 Mar;137(Pt 3):834-48
Parkin-mediated ubiquitination of mutant glucocerebrosidase leads to competition with its substrates PARIS and ARTS.
Bendikov-Bar I, Rapaport D, Larisch S, Horowitz M
Orphanet journal of rare diseases 2014 Jun 16;9:86
Orphanet journal of rare diseases 2014 Jun 16;9:86
Gaucher disease paradigm: from ERAD to comorbidity.
Bendikov-Bar I, Horowitz M
Human mutation 2012 Oct;33(10):1398-407
Human mutation 2012 Oct;33(10):1398-407
Characterization of the ERAD process of the L444P mutant glucocerebrosidase variant.
Bendikov-Bar I, Ron I, Filocamo M, Horowitz M
Blood cells, molecules & diseases 2011 Jan 15;46(1):4-10
Blood cells, molecules & diseases 2011 Jan 15;46(1):4-10
Characterization of Gaucher disease bone marrow mesenchymal stromal cells reveals an altered inflammatory secretome.
Campeau PM, Rafei M, Boivin MN, Sun Y, Grabowski GA, Galipeau J
Blood 2009 Oct 8;114(15):3181-90
Blood 2009 Oct 8;114(15):3181-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GBA monoclonal antibody (M01), clone 2E2 Western Blot analysis of GBA expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GBA expression in transfected 293T cell line by GBA monoclonal antibody (M01), clone 2E2.Lane 1: GBA transfected lysate(60 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GBA is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to GBA on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
