Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003766-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003766-M01, RRID:AB_534907
- Product name
- KCNJ10 monoclonal antibody (M01), clone 1C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KCNJ10.
- Antigen sequence
DFELVLILSGTVESTSATCQVRTSYLPEEILWGYE
FTPAISLSASGKYIADFSLFDQVVKVASPSGLRDS
TVRYGDPEKLKLEESLREQAEKEGSALSVRISNV- Isotype
- IgG
- Antibody clone number
- 1C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Free radical stress-mediated loss of Kcnj10 protein expression in stria vascularis contributes to deafness in Pendred syndrome mouse model.
Singh R, Wangemann P
American journal of physiology. Renal physiology 2008 Jan;294(1):F139-48
American journal of physiology. Renal physiology 2008 Jan;294(1):F139-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KCNJ10 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol