SAB2102011

RNASE11 antibody from Sigma-Aldrich
C14orf6, RAJ1
No application information provided.

Antibody data

Product number
SAB2102011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102011, RRID:AB_10605733
Product name
Anti-RNASE11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102011
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_660293.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLE
KILTVLTGHSLMSWL
Storage
-20C
Provider Type Product Number
- No reagents -