H00008289-M02
antibody from Abnova Corporation
Targeting: ARID1A
B120, BAF250, BAF250a, C10rf4, C1orf4, P270, SMARCF1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008289-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008289-M02, RRID:AB_10717626
- Product name
- ARID1A monoclonal antibody (M02), clone 3H14
- Antibody type
- Monoclonal
- Antigen
- ARID1A (NP_006006, 1216 a.a. ~ 1325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARID1A.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQ
GPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPY
DRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYS
PSRYP- Isotype
- IgG
- Vial size
- 100 μg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ARID1A alterations are associated with FGFR3-wild type, poor-prognosis, urothelial bladder tumors.
Balbás-Martínez C, Rodríguez-Pinilla M, Casanova A, Domínguez O, Pisano DG, Gómez G, Lloreta J, Lorente JA, Malats N, Real FX
PloS one 2013;8(5):e62483
PloS one 2013;8(5):e62483
No comments: Submit comment
No validations: Submit validation data