Explore
Validate
LearnHPA005456
antibody from Atlas Antibodies
Targeting: ARID1A
B120, BAF250, BAF250a, C10rf4, C1orf4, P270, SMARCF1
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [19]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005456 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005456, RRID:AB_1078205
- Product name
- Anti-ARID1A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNM
STGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQR
HDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Altered expression of AT-rich interactive domain 1A in hepatocellular carcinoma.
Integrated copy number and expression analysis identifies profiles of whole-arm chromosomal alterations and subgroups with favorable outcome in ovarian clear cell carcinomas.
Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma.
Synthetic lethality by targeting EZH2 methyltransferase activity in ARID1A-mutated cancers.
Frequent somatic mutations of the telomerase reverse transcriptase promoter in ovarian clear cell carcinoma but not in other major types of gynaecological malignancy.
Next-generation sequencing of endoscopic biopsies identifies ARID1A as a tumor-suppressor gene in Barrett's esophagus.
A functional proteogenomic analysis of endometrioid and clear cell carcinomas using reverse phase protein array and mutation analysis: protein expression is histotype-specific and loss of ARID1A/BAF250a is associated with AKT phosphorylation.
Loss of ARID1A expression correlates with stages of tumor progression in uterine endometrioid carcinoma.
Loss of ARID1A expression and its relationship with PI3K-Akt pathway alterations and ZNF217 amplification in ovarian clear cell carcinoma
Loss of ARID1A/BAF250a expression in ovarian endometriosis and clear cell carcinoma.
Loss of ARID1A expression is an early molecular event in tumor progression from ovarian endometriotic cyst to clear cell and endometrioid carcinoma.
Functional analysis of in-frame indel ARID1A mutations reveals new regulatory mechanisms of its tumor suppressor functions.
Endocervical-type mucinous borderline tumors are related to endometrioid tumors based on mutation and loss of expression of ARID1A.
PIK3CA mutations and loss of ARID1A protein expression are early events in the development of cystic ovarian clear cell adenocarcinoma
Molecular ontogeny of donor-derived follicular lymphomas occurring after hematopoietic cell transplantation.
Exome sequencing identifies frequent mutation of ARID1A in molecular subtypes of gastric cancer
Mutation and loss of expression of ARID1A in uterine low-grade endometrioid carcinoma.
Loss of ARID1A protein expression occurs as an early event in ovarian clear-cell carcinoma development and frequently coexists with PIK3CA mutations
Application of ARID1A to murine formalin-fixed paraffin embedded tissue using immunohistochemistry
Abe H, Hayashi A, Kunita A, Sakamoto Y, Hasegawa K, Shibahara J, Kokudo N, Fukayama M
International journal of clinical and experimental pathology 2015;8(3):2763-70
International journal of clinical and experimental pathology 2015;8(3):2763-70
Integrated copy number and expression analysis identifies profiles of whole-arm chromosomal alterations and subgroups with favorable outcome in ovarian clear cell carcinomas.
Uehara Y, Oda K, Ikeda Y, Koso T, Tsuji S, Yamamoto S, Asada K, Sone K, Kurikawa R, Makii C, Hagiwara O, Tanikawa M, Maeda D, Hasegawa K, Nakagawa S, Wada-Hiraike O, Kawana K, Fukayama M, Fujiwara K, Yano T, Osuga Y, Fujii T, Aburatani H
PloS one 2015;10(6):e0128066
PloS one 2015;10(6):e0128066
Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma.
He F, Li J, Xu J, Zhang S, Xu Y, Zhao W, Yin Z, Wang X
Journal of experimental & clinical cancer research : CR 2015 May 15;34(1):47
Journal of experimental & clinical cancer research : CR 2015 May 15;34(1):47
Synthetic lethality by targeting EZH2 methyltransferase activity in ARID1A-mutated cancers.
Bitler BG, Aird KM, Garipov A, Li H, Amatangelo M, Kossenkov AV, Schultz DC, Liu Q, Shih IeM, Conejo-Garcia JR, Speicher DW, Zhang R
Nature medicine 2015 Mar;21(3):231-8
Nature medicine 2015 Mar;21(3):231-8
Frequent somatic mutations of the telomerase reverse transcriptase promoter in ovarian clear cell carcinoma but not in other major types of gynaecological malignancy.
Wu RC, Ayhan A, Maeda D, Kim KR, Clarke BA, Shaw P, Chui MH, Rosen B, Shih IeM, Wang TL
The Journal of pathology 2014 Mar;232(4):473-81
The Journal of pathology 2014 Mar;232(4):473-81
Next-generation sequencing of endoscopic biopsies identifies ARID1A as a tumor-suppressor gene in Barrett's esophagus.
Streppel MM, Lata S, DelaBastide M, Montgomery EA, Wang JS, Canto MI, Macgregor-Das AM, Pai S, Morsink FH, Offerhaus GJ, Antoniou E, Maitra A, McCombie WR
Oncogene 2014 Jan 16;33(3):347-57
Oncogene 2014 Jan 16;33(3):347-57
A functional proteogenomic analysis of endometrioid and clear cell carcinomas using reverse phase protein array and mutation analysis: protein expression is histotype-specific and loss of ARID1A/BAF250a is associated with AKT phosphorylation.
Wiegand KC, Hennessy BT, Leung S, Wang Y, Ju Z, McGahren M, Kalloger SE, Finlayson S, Stemke-Hale K, Lu Y, Zhang F, Anglesio MS, Gilks B, Mills GB, Huntsman DG, Carey MS
BMC cancer 2014 Feb 22;14:120
BMC cancer 2014 Feb 22;14:120
Loss of ARID1A expression correlates with stages of tumor progression in uterine endometrioid carcinoma.
Mao TL, Ardighieri L, Ayhan A, Kuo KT, Wu CH, Wang TL, Shih IeM
The American journal of surgical pathology 2013 Sep;37(9):1342-8
The American journal of surgical pathology 2013 Sep;37(9):1342-8
Loss of ARID1A expression and its relationship with PI3K-Akt pathway alterations and ZNF217 amplification in ovarian clear cell carcinoma
Huang H, Lin M, Huang W, Chiang Y, Kuo K
Modern Pathology 2013 December;27(7):983-990
Modern Pathology 2013 December;27(7):983-990
Loss of ARID1A/BAF250a expression in ovarian endometriosis and clear cell carcinoma.
Xiao W, Awadallah A, Xin W
International journal of clinical and experimental pathology 2012;5(7):642-50
International journal of clinical and experimental pathology 2012;5(7):642-50
Loss of ARID1A expression is an early molecular event in tumor progression from ovarian endometriotic cyst to clear cell and endometrioid carcinoma.
Ayhan A, Mao TL, Seckin T, Wu CH, Guan B, Ogawa H, Futagami M, Mizukami H, Yokoyama Y, Kurman RJ, Shih IeM
International journal of gynecological cancer : official journal of the International Gynecological Cancer Society 2012 Oct;22(8):1310-5
International journal of gynecological cancer : official journal of the International Gynecological Cancer Society 2012 Oct;22(8):1310-5
Functional analysis of in-frame indel ARID1A mutations reveals new regulatory mechanisms of its tumor suppressor functions.
Guan B, Gao M, Wu CH, Wang TL, Shih IeM
Neoplasia (New York, N.Y.) 2012 Oct;14(10):986-93
Neoplasia (New York, N.Y.) 2012 Oct;14(10):986-93
Endocervical-type mucinous borderline tumors are related to endometrioid tumors based on mutation and loss of expression of ARID1A.
Wu CH, Mao TL, Vang R, Ayhan A, Wang TL, Kurman RJ, Shih IeM
International journal of gynecological pathology : official journal of the International Society of Gynecological Pathologists 2012 Jul;31(4):297-303
International journal of gynecological pathology : official journal of the International Society of Gynecological Pathologists 2012 Jul;31(4):297-303
PIK3CA mutations and loss of ARID1A protein expression are early events in the development of cystic ovarian clear cell adenocarcinoma
Yamamoto S, Tsuda H, Takano M, Tamai S, Matsubara O
Virchows Archiv 2012 January;460(1):77-87
Virchows Archiv 2012 January;460(1):77-87
Molecular ontogeny of donor-derived follicular lymphomas occurring after hematopoietic cell transplantation.
Weigert O, Kopp N, Lane AA, Yoda A, Dahlberg SE, Neuberg D, Bahar AY, Chapuy B, Kutok JL, Longtine JA, Kuo FC, Haley T, Salois M, Sullivan TJ, Fisher DC, Fox EA, Rodig SJ, Antin JH, Weinstock DM
Cancer discovery 2012 Jan;2(1):47-55
Cancer discovery 2012 Jan;2(1):47-55
Exome sequencing identifies frequent mutation of ARID1A in molecular subtypes of gastric cancer
Wang K, Kan J, Yuen S, Shi S, Chu K, Law S, Chan T, Kan Z, Chan A, Tsui W, Lee S, Ho S, Chan A, Cheng G, Roberts P, Rejto P, Gibson N, Pocalyko D, Mao M, Xu J, Leung S
Nature Genetics 2011 October;43(12):1219-1223
Nature Genetics 2011 October;43(12):1219-1223
Mutation and loss of expression of ARID1A in uterine low-grade endometrioid carcinoma.
Guan B, Mao TL, Panuganti PK, Kuhn E, Kurman RJ, Maeda D, Chen E, Jeng YM, Wang TL, Shih IeM
The American journal of surgical pathology 2011 May;35(5):625-32
The American journal of surgical pathology 2011 May;35(5):625-32
Loss of ARID1A protein expression occurs as an early event in ovarian clear-cell carcinoma development and frequently coexists with PIK3CA mutations
Yamamoto S, Tsuda H, Takano M, Tamai S, Matsubara O
Modern Pathology 2011 December;25(4):615-624
Modern Pathology 2011 December;25(4):615-624
Application of ARID1A to murine formalin-fixed paraffin embedded tissue using immunohistochemistry
Howat W, Miller J, Gounaris I
F1000Research
F1000Research
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in NTERA-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ARID1A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows weak to moderate nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
