HPA021032

antibody from Atlas Antibodies

Targeting: HSD17B1 EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1

Antibody data

Submit

Validation data

Product number: HPA021032 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021032, RRID:AB_1844345
Product name: Anti-HSD17B1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIH TFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALR APKPTL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HSD17B1 protein structure - HPA021032 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and prostate tissues using Anti-HSD17B1 antibody. Corresponding HSD17B1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, lymph node, placenta and prostate using Anti-HSD17B1 antibody HPA021032 (A) shows similar protein distribution across tissues to independent antibody HPA065296 (B).
Antibody #2 product nr: HPA065296
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-HSD17B1 antibody HPA021032.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-HSD17B1 antibody HPA021032.
Sample type: HUMAN