H00003292-M03
antibody from Abnova Corporation
Targeting: HSD17B1
EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003292-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003292-M03, RRID:AB_565425
- Product name
- HSD17B1 monoclonal antibody (M03), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HSD17B1.
- Antigen sequence
VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHS
KQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTE
RFLPLLRMRLDDPSGSNYVTAMHREVF- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The role of estrogen-metabolizing enzymes and estrogen receptors in human epidermis.
Increased estrogen sulfatase (STS) and 17beta-hydroxysteroid dehydrogenase type 1(17beta-HSD1) following neoadjuvant aromatase inhibitor therapy in breast cancer patients.
Inoue T, Miki Y, Abe K, Hatori M, Hosaka M, Kariya Y, Kakuo S, Fujimura T, Hachiya A, Aiba S, Sasano H
Molecular and cellular endocrinology 2011 Sep 15;344(1-2):35-40
Molecular and cellular endocrinology 2011 Sep 15;344(1-2):35-40
Increased estrogen sulfatase (STS) and 17beta-hydroxysteroid dehydrogenase type 1(17beta-HSD1) following neoadjuvant aromatase inhibitor therapy in breast cancer patients.
Chanplakorn N, Chanplakorn P, Suzuki T, Ono K, Chan MS, Miki Y, Saji S, Ueno T, Toi M, Sasano H
Breast cancer research and treatment 2010 Apr;120(3):639-48
Breast cancer research and treatment 2010 Apr;120(3):639-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HSD17B1 monoclonal antibody (M03), clone 2E5 Western Blot analysis of HSD17B1 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HSD17B1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol