Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108984 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SERTA Domain Containing 1 (SERTAD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SERTAD1 antibody: synthetic peptide directed towards the N terminal of human SERTAD1
- Description
- Purified using Protein A affinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQ
APPAVASSSLFDLSV- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Dissection of CDK4-binding and transactivation activities of p34(SEI-1) and comparison between functions of p34(SEI-1) and p16(INK4A).
Li J, Muscarella P, Joo SH, Knobloch TJ, Melvin WS, Weghorst CM, Tsai MD
Biochemistry 2005 Oct 11;44(40):13246-56
Biochemistry 2005 Oct 11;44(40):13246-56
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Placenta; WB Suggested Anti-SERTAD1 Antibody Titration: 0.125ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta; SERTAD1 antibody - N-terminal region (AP42274PU-N) in Human Placenta cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Muscle; SERTAD1 antibody - N-terminal region (AP42274PU-N) in Human Muscle cells using Immunohistochemistry