HPA072229

TAF1C antibody from Atlas Antibodies
MGC:39976, SL1, TAFI110, TAFI95

Antibody data

Product number
HPA072229
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA072229, RRID:AB_2686499
Product name
Anti-TAF1C
Provider product page
Atlas Antibodies - HPA072229
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGP
PGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKC
LPPTLHLVCTQFSLYLVDE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -