ARP40130_P050

TAF1C antibody from Aviva Systems Biology
MGC:39976, SL1, TAFI110, TAFI95
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
ARP40130_P050
Provider
Aviva Systems Biology
Proper citation
Aviva Systems Biology Cat#ARP40130_P050, RRID:AB_10713400
Product name
Taf1c antibody - C-terminal region (ARP40130_P050)
Provider product page
Aviva Systems Biology - ARP40130_P050
Antibody type
Polyclonal
Antigen
Synthetic peptide
Description
This is a rabbit polyclonal antibody against Taf1c. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
RRHRGETSETQTQSKRPKRRTQLSSTFSSFTSYLD
SPDASSAPRSQDLST
Vial size
50 µg
Concentration
1 mg/ml
Handling
Add 50 µl of distilled water. Final anti-Taf1c antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Provider Type Product Number
- No reagents -