Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016952 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016952, RRID:AB_1858680
- Product name
- Anti-USP30
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIH
LQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLL
GHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQP
GAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDY
SSST- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy
Bingol B, Tea J, Phu L, Reichelt M, Bakalarski C, Song Q, Foreman O, Kirkpatrick D, Sheng M
Nature 2014 June
Nature 2014 June
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and USP30 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409983).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in renal tubules cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN