Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002870-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002870-M10, RRID:AB_606329
- Product name
- GRK6 monoclonal antibody (M10), clone 8D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GRK6.
- Antigen sequence
CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQL
TQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKD
LFQELTRLTHEYLSVAPFADYLDSIYFNRF- Isotype
- IgG
- Antibody clone number
- 8D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Impaired recruitment of Grk6 and beta-Arrestin 2 causes delayed internalization and desensitization of a WHIM syndrome-associated CXCR4 mutant receptor.
McCormick PJ, Segarra M, Gasperini P, Gulino AV, Tosato G
PloS one 2009 Dec 1;4(12):e8102
PloS one 2009 Dec 1;4(12):e8102
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GRK6 monoclonal antibody (M10), clone 8D4 Western Blot analysis of GRK6 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GRK6 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol