Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109505 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytosolic Iron-Sulfur Protein Assembly 1 (CIAO1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WDR39 antibody: synthetic peptide directed towards the C terminal of human WDR39
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
LSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQE
DPNSDPQQPTFSLTA- Epitope
- C-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Ciao 1 is a novel WD40 protein that interacts with the tumor suppressor protein WT1.
Johnstone RW, Wang J, Tommerup N, Vissing H, Roberts T, Shi Y
The Journal of biological chemistry 1998 May 1;273(18):10880-7
The Journal of biological chemistry 1998 May 1;273(18):10880-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-WDR39 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate. CIAO1 is supported by BioGPS gene expression data to be expressed in Jurkat.; WDR39 antibody - C-terminal region (AP42288PU-N) in Human Jurkat cells using Western Blot
