HPA026785

SLC25A39 antibody from Atlas Antibodies
CGI-69, FLJ22407
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026785
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026785, RRID:AB_10601715
Product name
Anti-SLC25A39
Provider product page
Atlas Antibodies - HPA026785
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNG
VLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIV
RHEGTRTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -