AV43962

SLC25A39 antibody from MilliporeSigma / Merck KGaA
CGI-69, FLJ22407
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV43962
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV43962, RRID:AB_1846599
Product name
Anti-SLC25A39 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV43962
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SLC25A39 with an internal ID of P11703
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKA
APSCAIMISTYEFGK
Storage
-20C
Provider Type Product Number
- No reagents -