Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011178-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011178-A01, RRID:AB_463055
- Product name
- LZTS1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LZTS1.
- Antigen sequence
ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQ
SYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEG
ADIPYEDIIATEI- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MicroRNA-135b promotes lung cancer metastasis by regulating multiple targets in the Hippo pathway and LZTS1.
Lin CW, Chang YL, Chang YC, Lin JC, Chen CC, Pan SH, Wu CT, Chen HY, Yang SC, Hong TM, Yang PC
Nature communications 2013;4:1877
Nature communications 2013;4:1877
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LZTS1 polyclonal antibody (A01), Lot # 051108JC01 Western Blot analysis of LZTS1 expression in SJCRH30 ( Cat # L027V1 ).