Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182818 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Wingless-Type MMTV Integration Site Family, Member 8B (WNT8B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the middle region of human WNT8B
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAA
LKVDL LQGAGNSAAG- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression and regulation of WNT8A and WNT8B mRNAs in human tumor cell lines: up-regulation of WNT8B mRNA by beta-estradiol in MCF-7 cells, and down-regulation of WNT8A and WNT8B mRNAs by retinoic acid in NT2 cells.
Saitoh T, Mine T, Katoh M
International journal of oncology 2002 May;20(5):999-1003
International journal of oncology 2002 May;20(5):999-1003
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting