Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501911 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 800 (ZNF800) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF800 antibody: synthetic peptide directed towards the N terminal of human ZNF800
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
MPLRDKYCQTDHHHHGCCEPVYILEPGDPPLLQQP
LQTSK SGIQQIIECF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
Denoeud F, Kapranov P, Ucla C, Frankish A, Castelo R, Drenkow J, Lagarde J, Alioto T, Manzano C, Chrast J, Dike S, Wyss C, Henrichsen CN, Holroyd N, Dickson MC, Taylor R, Hance Z, Foissac S, Myers RM, Rogers J, Hubbard T, Harrow J, Guigó R, Gingeras TR, Antonarakis SE, Reymond A
Genome research 2007 Jun;17(6):746-59
Genome research 2007 Jun;17(6):746-59
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting