Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006499 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006499, RRID:AB_1079596
- Product name
- Anti-PFDN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDT
EIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQ
KIAEEKIKELEQKKSYLERSVKEAEDNIREMLMAR
RA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Prefoldin subunits are protected from ubiquitin-proteasome system-mediated degradation by forming complex with other constituent subunits.
Miyazawa M, Tashiro E, Kitaura H, Maita H, Suto H, Iguchi-Ariga SM, Ariga H
The Journal of biological chemistry 2011 Jun 3;286(22):19191-203
The Journal of biological chemistry 2011 Jun 3;286(22):19191-203
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoli, plasma membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN