Explore
Validate
Learn
Immunocytochemistry
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015475 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015475, RRID:AB_1854574
- Product name
- Anti-NOX4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEF
TQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCA
ERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENF
KARPGQYI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Genome-wide methylation profiling identifies an essential role of reactive oxygen species in pediatric glioblastoma multiforme and validates a methylome specific for H3 histone family 3A with absence of G-CIMP/isocitrate dehydrogenase 1 mutation.
Modulation of redox signaling promotes apoptosis in epithelial ovarian cancer cells.
Jha P, Pia Patric IR, Shukla S, Pathak P, Pal J, Sharma V, Thinagararanjan S, Santosh V, Suri V, Sharma MC, Arivazhagan A, Suri A, Gupta D, Somasundaram K, Sarkar C
Neuro-oncology 2014 Dec;16(12):1607-17
Neuro-oncology 2014 Dec;16(12):1607-17
Modulation of redox signaling promotes apoptosis in epithelial ovarian cancer cells.
Jiang Z, Fletcher NM, Ali-Fehmi R, Diamond MP, Abu-Soud HM, Munkarah AR, Saed GM
Gynecologic oncology 2011 Aug;122(2):418-23
Gynecologic oncology 2011 Aug;122(2):418-23
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to nucleus.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and pancreas tissues using HPA015475 antibody. Corresponding NOX4 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in proximal tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate positivity in exocrine glandular cells.
- Sample type
- HUMAN
