HPA029878

KPNB1 antibody from Atlas Antibodies
IMB1, Impnb, IPO1, IPOB, MGC2155, MGC2156, MGC2157, NTF97
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029878
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029878, RRID:AB_10670041
Product name
Anti-KPNB1
Provider product page
Atlas Antibodies - HPA029878
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVE
VLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVG
LVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHR
SVKPQILSVFGDIAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -