HPA029878

antibody from Atlas Antibodies

Targeting: KPNB1 IMB1, Impnb, IPO1, IPOB, MGC2155, MGC2156, MGC2157, NTF97

Antibody data

Submit

Validation data

Product number: HPA029878 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029878, RRID:AB_10670041
Product name: Anti-KPNB1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVE VLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVG LVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHR SVKPQILSVFGDIAL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KPNB1 protein structure - HPA029878 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA029878 antibody. Corresponding KPNB1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong nuclear and nuclear membrane positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear and nuclear membrane positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate nuclear and nuclear membrane positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate nuclear and nuclear membrane positivity in cells in glomerulus and tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows weak nuclear positivity in myocytes.
Sample type: HUMAN