Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009971-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009971-M02, RRID:AB_626482
- Product name
- NR1H4 monoclonal antibody (M02), clone 1B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NR1H4.
- Antigen sequence
TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQY
IKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFAC
LLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCE
IWDVQ- Isotype
- IgG
- Antibody clone number
- 1B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Binding of hepatitis B virus to its cellular receptor alters the expression profile of genes of bile acid metabolism.
Bile salt export pump is dysregulated with altered farnesoid X receptor isoform expression in patients with hepatocellular carcinoma.
Oehler N, Volz T, Bhadra OD, Kah J, Allweiss L, Giersch K, Bierwolf J, Riecken K, Pollok JM, Lohse AW, Fehse B, Petersen J, Urban S, Lütgehetmann M, Heeren J, Dandri M
Hepatology (Baltimore, Md.) 2014 Nov;60(5):1483-93
Hepatology (Baltimore, Md.) 2014 Nov;60(5):1483-93
Bile salt export pump is dysregulated with altered farnesoid X receptor isoform expression in patients with hepatocellular carcinoma.
Chen Y, Song X, Valanejad L, Vasilenko A, More V, Qiu X, Chen W, Lai Y, Slitt A, Stoner M, Yan B, Deng R
Hepatology (Baltimore, Md.) 2013 Apr;57(4):1530-41
Hepatology (Baltimore, Md.) 2013 Apr;57(4):1530-41
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NR1H4 monoclonal antibody (M02), clone 1B10 Western Blot analysis of NR1H4 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NR1H4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NR1H4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol