HPA005798

GRHL1 antibody from Atlas Antibodies
LBP-32, MGR, TFCP2L2

Antibody data

Product number
HPA005798
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005798, RRID:AB_1079026
Product name
Anti-GRHL1
Provider product page
Atlas Antibodies - HPA005798
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIA
SEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEE
PKRVLLYVRKESEEVFDALMLKTPSLKGL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.