WH0002068M1

ERCC2 antibody from MilliporeSigma / Merck KGaA
EM9, MAG, MGC102762, MGC126218, MGC126219, TFIIH, XPD
ELISA
Recommended by provider

Antibody data

Product number
WH0002068M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0002068M1, RRID:AB_1844248
Product name
Monoclonal Anti-ERCC2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0002068M1
Antibody type
Monoclonal
Antigen
ERCC2 (AAH08346, a.a. 1-406) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAY
QRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFY
EKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKD
VDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAH
GREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSI
LHANVVVYSYHYLLDPKIADLVSKELARKAVVVFD
EAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKT
VLRIKETDEQ (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -