HPA062273

antibody from Atlas Antibodies

Targeting: IGF2BP1 IMP-1

Antibody data

Submit

Validation data

Product number: HPA062273 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA062273, RRID:AB_2684733
Product name: Anti-IGF2BP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGS PVAAGAPAKQQQVDI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

IGF2BP1 protein structure - HPA062273 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using Anti-IGF2BP1 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, ovary and testis using Anti-IGF2BP1 antibody HPA062273 (A) shows similar protein distribution across tissues to independent antibody HPA021367 (B).
Antibody #2 product nr: HPA021367
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-IGF2BP1 antibody HPA062273.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human ovary using Anti-IGF2BP1 antibody HPA062273.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-IGF2BP1 antibody HPA062273.
Sample type: HUMAN