HPA027614

antibody from Atlas Antibodies

Targeting: MYBPC1 ssMyBP-C

Antibody data

Submit

Validation data

Product number: HPA027614 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA027614, RRID:AB_10602711
Product name: Anti-MYBPC1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAV NLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSET DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQ IIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAA IT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MYBPC1 protein structure - HPA027614 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-MYBPC1 antibody. Corresponding MYBPC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, lymph node and skeletal muscle using Anti-MYBPC1 antibody HPA027614 (A) shows similar protein distribution across tissues to independent antibody HPA021004 (B).
Antibody #2 product nr: HPA021004
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MYBPC1 antibody HPA027614.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MYBPC1 antibody HPA027614.
Sample type: HUMAN