Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001748-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001748-M01, RRID:AB_489714
- Product name
- DLX4 monoclonal antibody (M01), clone 1F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DLX4.
- Antigen sequence
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGL
SPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYL
SCQQPAALSQPLCGPAEHPQELEADSEK- Isotype
- IgG
- Antibody clone number
- 1F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references DLX4 is associated with orofacial clefting and abnormal jaw development.
Homeodomain protein DLX4 counteracts key transcriptional control mechanisms of the TGF-β cytostatic program and blocks the antiproliferative effect of TGF-β.
A homeobox gene related to Drosophila distal-less promotes ovarian tumorigenicity by inducing expression of vascular endothelial growth factor and fibroblast growth factor-2.
Wu D, Mandal S, Choi A, Anderson A, Prochazkova M, Perry H, Gil-Da-Silva-Lopes VL, Lao R, Wan E, Tang PL, Kwok PY, Klein O, Zhuan B, Slavotinek AM
Human molecular genetics 2015 Aug 1;24(15):4340-52
Human molecular genetics 2015 Aug 1;24(15):4340-52
Homeodomain protein DLX4 counteracts key transcriptional control mechanisms of the TGF-β cytostatic program and blocks the antiproliferative effect of TGF-β.
Trinh BQ, Barengo N, Naora H
Oncogene 2011 Jun 16;30(24):2718-29
Oncogene 2011 Jun 16;30(24):2718-29
A homeobox gene related to Drosophila distal-less promotes ovarian tumorigenicity by inducing expression of vascular endothelial growth factor and fibroblast growth factor-2.
Hara F, Samuel S, Liu J, Rosen D, Langley RR, Naora H
The American journal of pathology 2007 May;170(5):1594-606
The American journal of pathology 2007 May;170(5):1594-606
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody (M01), clone 1F11.Lane 1: DLX4 transfected lysate(26 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DLX4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of DLX4 transfected lysate using anti-DLX4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DLX4 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
