Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501291 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Distal-Less Homeobox 4 (DLX4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of human DLX4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
PQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLAL
PERAQ LAAQLGLTQT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Overexpression of BP1, a homeobox gene, is associated with resistance to all-trans retinoic acid in acute promyelocytic leukemia cells.
Awwad RT, Do K, Stevenson H, Fu SW, Lo-Coco F, Costello M, Campbell CL, Berg PE
Annals of hematology 2008 Mar;87(3):195-203
Annals of hematology 2008 Mar;87(3):195-203
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting