Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009412-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009412-M03, RRID:AB_875864
- Product name
- SURB7 monoclonal antibody (M03), clone 6B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SURB7.
- Antigen sequence
MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASF
NNIQTAINKDQPANPTEEYAQLFAALIARTAKDID
VLIDSLPSEESTAALQAASLYKLEEENHEAATCLE
DVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS
LPDS- Isotype
- IgG
- Antibody clone number
- 6B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SURB7 monoclonal antibody (M03), clone 6B6 Western Blot analysis of SURB7 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SURB7 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SURB7 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol