Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004322-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004322-M07, RRID:AB_581728
- Product name
- MMP13 monoclonal antibody (M07), clone 3B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MMP13.
- Antigen sequence
ILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLL
FSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKV
DAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPAN
SILWC- Isotype
- IgG
- Antibody clone number
- 3B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MMP13 expression in transfected 293T cell line by MMP13 monoclonal antibody (M07), clone 3B11.Lane 1: MMP13 transfected lysate(53.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MMP13 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of MMP13 transfected lysate using anti-MMP13 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MMP13 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol