HPA072785

GATAD1 antibody from Atlas Antibodies
FLJ22489, ODAG, RG083M05.2

Antibody data

Product number
HPA072785
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA072785, RRID:AB_2686556
Product name
Anti-GATAD1
Provider product page
Atlas Antibodies - HPA072785
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTG
R
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -