Explore
Validate
LearnH00057016-M01
antibody from Abnova Corporation
Targeting: AKR1B10
AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057016-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057016-M01, RRID:AB_509242
- Product name
- AKR1B10 monoclonal antibody (M01), clone 1A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AKR1B10.
- Antigen sequence
VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLI
HWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE- Isotype
- IgG
- Antibody clone number
- 1A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Quantification of the host response proteome after herpes simplex virus type 1 infection.
A therapeutic method for the direct reprogramming of human liver cancer cells with only chemicals.
An integrated functional genomics approach identifies the regulatory network directed by brachyury (T) in chordoma.
Overexpression and oncogenic function of aldo-keto reductase family 1B10 (AKR1B10) in pancreatic carcinoma.
Combined functional genome survey of therapeutic targets for hepatocellular carcinoma.
Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin.
Berard AR, Coombs KM, Severini A
Journal of proteome research 2015 May 1;14(5):2121-42
Journal of proteome research 2015 May 1;14(5):2121-42
A therapeutic method for the direct reprogramming of human liver cancer cells with only chemicals.
Moriguchi H, Zhang Y, Mihara M, Sato C
Scientific reports 2012;2:280
Scientific reports 2012;2:280
An integrated functional genomics approach identifies the regulatory network directed by brachyury (T) in chordoma.
Nelson AC, Pillay N, Henderson S, Presneau N, Tirabosco R, Halai D, Berisha F, Flicek P, Stemple DL, Stern CD, Wardle FC, Flanagan AM
The Journal of pathology 2012 Nov;228(3):274-85
The Journal of pathology 2012 Nov;228(3):274-85
Overexpression and oncogenic function of aldo-keto reductase family 1B10 (AKR1B10) in pancreatic carcinoma.
Chung YT, Matkowskyj KA, Li H, Bai H, Zhang W, Tsao MS, Liao J, Yang GY
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2012 May;25(5):758-66
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2012 May;25(5):758-66
Combined functional genome survey of therapeutic targets for hepatocellular carcinoma.
Satow R, Shitashige M, Kanai Y, Takeshita F, Ojima H, Jigami T, Honda K, Kosuge T, Ochiya T, Hirohashi S, Yamada T
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 May 1;16(9):2518-28
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 May 1;16(9):2518-28
Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin.
Bains OS, Grigliatti TA, Reid RE, Riggs KW
The Journal of pharmacology and experimental therapeutics 2010 Dec;335(3):533-45
The Journal of pharmacology and experimental therapeutics 2010 Dec;335(3):533-45
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AKR1B10 monoclonal antibody (M01), clone 1A6 Western Blot analysis of AKR1B10 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1B10 transfected lysate(36 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to AKR1B10 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
