Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109360 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-TSC22 Domain Family, Member 4 (TSC22D4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4
- Description
- Protein A affinity column
- Reactivity
- Human, Porcine
- Host
- Rabbit
- Antigen sequence
SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPP
TGPPPRLPNGEPSPD- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term
- Handling
- Avoid repeated freezing and thawing.
Submitted references Human chromosome 7: DNA sequence and biology.
Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Döhner H, Döhner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC
Science (New York, N.Y.) 2003 May 2;300(5620):767-72
Science (New York, N.Y.) 2003 May 2;300(5620):767-72
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-TSC22D4 Antibody Titration: 0.5ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate; TSC22D4 antibody - N-terminal region (AP42016PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Lung; Rabbit Anti-TSC22D4 Antibody. Paraffin Embedded Tissue: Human Lung. Cellular Data: Alveolar cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; TSC22D4 antibody - N-terminal region (AP42016PU-N) in Human Lung cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human kidney; Rabbit Anti-TSC22D4 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; TSC22D4 antibody - N-terminal region (AP42016PU-N) in Human kidney cells using Immunohistochemistry