Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009065 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009065, RRID:AB_1857390
- Product name
- Anti-SOX7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAY
YSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQL
SQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSG
HVPVSQVTPTGPTETSLISVLADATATYYNSYS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SOX7 is down-regulated in lung cancer.
Sox4 functions as a positive regulator of β-catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas
Hayano T, Garg M, Yin D, Sudo M, Kawamata N, Shi S, Chien W, Ding LW, Leong G, Mori S, Xie D, Tan P, Koeffler HP
Journal of experimental & clinical cancer research : CR 2013 Apr 4;32(1):17
Journal of experimental & clinical cancer research : CR 2013 Apr 4;32(1):17
Sox4 functions as a positive regulator of β-catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas
Saegusa M, Hashimura M, Kuwata T
Laboratory Investigation 2012 January;92(4):511-521
Laboratory Investigation 2012 January;92(4):511-521
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.
- Sample type
- HUMAN