WH0006879M1

TAF7 antibody from MilliporeSigma / Merck KGaA
TAF2F, TAFII55
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0006879M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-TAF7 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0006879M1
Antibody type
Monoclonal
Antigen
TAF7 (AAH32737, a.a. 130-224) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEK
EVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDI
SSPGMSGHRQGHDSLEHDELREIFN (without
GST)
Isotype
IgG
Storage
-20C