WH0010194M7

TSHZ1 antibody from MilliporeSigma / Merck KGaA
NY-CO-33, SDCCAG33, TSH1
ELISA
Recommended by provider

Antibody data

Product number
WH0010194M7
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0010194M7, RRID:AB_1843511
Product name
Monoclonal Anti-SDCCAG33 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0010194M7
Antibody type
Monoclonal
Antigen
SDCCAG33 (NP_005777, a.a. 619-718) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAE
TGKAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGII
MDHSPEPSFINPLSALQSIMNTHLGKVSK* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -